PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR08G19120.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family bZIP
Protein Properties Length: 465aa    MW: 49767.1 Da    PI: 7.2574
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR08G19120.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1331.3e-10323381563
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      kr +r   NR +A rs +RK  +i+eLe kv++L++e ++L  +l +l+  ++ l +++
  LPERR08G19120.1 323 KRVKRILANRQSAARSKERKMRYIQELEHKVQVLQTEATTLSAQLTMLQRDSSGLATQN 381
                      899********************************************999888776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.6E-18319383IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.875321384IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.14E-12323373No hitNo description
Gene3DG3DSA:1.20.5.1708.4E-12323380No hitNo description
PfamPF001701.9E-9323381IPR004827Basic-leucine zipper domain
CDDcd147035.73E-22324373No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
MDDGGAGDPR HQASPQPTGG GGGQPPRSPT PLDLSAAAYR RLSPSLRPPA HPQVRLPSPY  60
PQIPSPAAAS GHHHHHSRSL SQPLFFSLDS LPPLPYADLA PPPPAIPPSP PSSTSDNPSI  120
PHGLPPRKGG NHHRRSQSDI PFGFSQLSPP LPPAPPPPPV KREGGRSDGG DDAALYDLVN  180
SYMDLDGMDA LNSSDEPHED RDSRASGNRA GSAAESSENE AESHSNSVER NDGGSKSRHC  240
RSLSVDSFMG KLNFAAGDES PKLPLPSPSG GGGGLSRSGS GSLDGGAAIL FGAESANWEF  300
SEAEKKKIMA NERLAEIALT DPKRVKRILA NRQSAARSKE RKMRYIQELE HKVQVLQTEA  360
TTLSAQLTML QRDSSGLATQ NNELKIRLQA MEQQAQLRDA LNEALTAEVQ RLKLATGEIS  420
DGRMSKGLQQ QMNSQLIQLQ QLQIQQQQSS QTTQQGQQQQ SQKSA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001147562.10.0uncharacterized protein LOC100281171
TrEMBLA0A0D9XAF30.0A0A0D9XAF3_9ORYZ; Uncharacterized protein
STRINGGRMZM2G175280_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62473650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-72bZIP family protein